PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g081380.1
Common NameMTR_3g081380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 190aa    MW: 21015.1 Da    PI: 8.6076
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g081380.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-12106147345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W++ E+ ll++a  ++G ++W+ +a+++g +++  +c+++++
  Medtr3g081380.1 106 DWSAHEERLLLEALDMYGFENWNGVAEHVG-TKSKPECIDHYN 147
                      5*****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002910.00114388IPR000433Zinc finger, ZZ-type
PROSITE profilePS501359.9014390IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.94E-1244109No hitNo description
PfamPF005691.3E-64787IPR000433Zinc finger, ZZ-type
CDDcd023358.50E-204895No hitNo description
PROSITE patternPS0135704976IPR000433Zinc finger, ZZ-type
SuperFamilySSF466898.22E-12100153IPR009057Homeodomain-like
PROSITE profilePS5129320.145102154IPR017884SANT domain
SMARTSM007171.5E-9103152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-7106147IPR009057Homeodomain-like
PfamPF002493.1E-11106147IPR001005SANT/Myb domain
CDDcd001673.28E-11107147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MGHKNRSKKK SAAFGSKKKK SALNAEGLET SFAGMAVTDG KVSLYRCKCN YCKTDISGKA  60
HIKCAVCQDF NLCVKCFSVG AEVTPHKSNH PYRVMEDLSF PLTCPDWSAH EERLLLEALD  120
MYGFENWNGV AEHVGTKSKP ECIDHYNGVY LNSPCAPLPD LSYCKGKNKE ELRAMGKRDQ  180
LKKGDKALE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013461146.11e-140transcriptional adapter ADA2
SwissprotQ75LL66e-65TADA2_ORYSJ; Transcriptional adapter ADA2
SwissprotQ9ATB43e-65TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A072VAF91e-140A0A072VAF9_MEDTR; Transcriptional adapter ADA2
STRINGGLYMA13G11200.24e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]